Lineage for d2duka_ (2duk A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2971307Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2971308Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2971309Family d.113.1.1: MutT-like [55812] (17 proteins)
  6. 2971606Protein automated matches [190465] (6 species)
    not a true protein
  7. 2971649Species Mouse (Mus musculus) [TaxId:10090] [187640] (1 PDB entry)
  8. 2971650Domain d2duka_: 2duk A: [163705]
    automated match to d2fvva1

Details for d2duka_

PDB Entry: 2duk (more details), 2.62 Å

PDB Description: Crystal structure of MS0616
PDB Compounds: (A:) ms0616

SCOPe Domain Sequences for d2duka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2duka_ d.113.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
trtydregfkkraaclcfrseqedevllvsssrypdqwivpgggmepeeepggaavrevy
eeagvkgklgrllgifenqdrkhrtyvyvltvteiledwedsvnigrkrewfkvedaikv
lqchkpvhaeyleklklg

SCOPe Domain Coordinates for d2duka_:

Click to download the PDB-style file with coordinates for d2duka_.
(The format of our PDB-style files is described here.)

Timeline for d2duka_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2dukb_