Lineage for d2dsrg1 (2dsr G:151-229)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 891925Fold g.28: Thyroglobulin type-1 domain [57609] (1 superfamily)
    disulfide-rich, alpha+beta
  4. 891926Superfamily g.28.1: Thyroglobulin type-1 domain [57610] (1 family) (S)
  5. 891927Family g.28.1.1: Thyroglobulin type-1 domain [57611] (4 proteins)
    Pfam PF00086
  6. 891940Protein Insulin-like growth factor-binding protein 4, IGFBP4 [161144] (1 species)
  7. 891941Species Human (Homo sapiens) [TaxId:9606] [161145] (1 PDB entry)
    Uniprot P22692 172-250
  8. 891942Domain d2dsrg1: 2dsr G:151-229 [145094]
    Other proteins in same PDB: d2dsrb1, d2dsri1

Details for d2dsrg1

PDB Entry: 2dsr (more details), 2.1 Å

PDB Description: Structural Basis for the Inhibition of Insulin-like Growth Factors by IGF Binding Proteins
PDB Compounds: (G:) Insulin-like growth factor-binding protein 4

SCOP Domain Sequences for d2dsrg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dsrg1 g.28.1.1 (G:151-229) Insulin-like growth factor-binding protein 4, IGFBP4 {Human (Homo sapiens) [TaxId: 9606]}
gscqselhralerlaasqsrthedlyiipipncdrngnfhpkqchpaldgqrgkcwcvdr
ktgvklpgglepkgeldch

SCOP Domain Coordinates for d2dsrg1:

Click to download the PDB-style file with coordinates for d2dsrg1.
(The format of our PDB-style files is described here.)

Timeline for d2dsrg1: