Lineage for d2dr1a_ (2dr1 A:)
- Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the restSuperfamily c.67.1: PLP-dependent transferases [53383] (10 families) 
Family c.67.1.0: automated matches [191328] (1 protein)
not a true familyProtein automated matches [190151] (121 species)
not a true protein
Species Pyrococcus horikoshii OT3 [TaxId:70601] [225184] (6 PDB entries) 
Domain d2dr1a_: 2dr1 A: [204032]
automated match to d1m32b_
complexed with cl, na, plp
Details for d2dr1a_
PDB Entry: 2dr1 (more details), 1.9 Å
PDB Description: Crystal structure of the PH1308 protein from Pyrococcus horikoshii OT3
PDB Compounds: (A:) 386aa long hypothetical serine aminotransferaseSCOPe Domain Sequences for d2dr1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dr1a_ c.67.1.0 (A:) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]}
efeeafkevyemvkpkyklftagpvacfpevleimkvqmfshrskeyrkvhmdtverlre
flevekgevllvpssgtgimeasirngvskggkvlvtiigafgkrykevvesngrkavvl
eyepgkavkpedlddalrknpdveavtitynetstgvlnplpelakvakehdklvfvdav
samggadikfdkwgldvvfsssqkafgvppglaigafserfleiaekmpergwyfdiply
vkylkekestpstppmpqvfginvalriiekmggkekwlemyekrakmvregvreigldi
laepghesptitavltppgikgdevyeamrkrgfelakgygsvkektfrighmgymkfed
iqemldnlrevinelkkqkgi
SCOPe Domain Coordinates for d2dr1a_:
Click to download the PDB-style file with coordinates for d2dr1a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2dr1a_:
- d2dr1a_ first appeared in SCOPe 2.03
- d2dr1a_ appears in SCOPe 2.05
- d2dr1a_ appears in SCOPe 2.07
- d2dr1a_ appears in the current release, SCOPe 2.08
View in 3D
