Lineage for d2dpka1 (2dpk A:370-502)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.27: CalX-like [141072] (2 families) 
Family b.1.27.1: CalX-beta domain [141073] (2 proteins)
Pfam PF03160
Protein Sodium/calcium exchanger 1 [141074] (1 species) Species Dog (Canis familiaris) [TaxId:9615] [141075] (3 PDB entries)
Uniprot P23685 402-534! Uniprot P23685 403-541! Uniprot P23685 533-724
Domain d2dpka1: 2dpk A:370-502 [131616]
Other proteins in same PDB: d2dpka2
1st CalX-beta domain
complexed with ca, epe, gai
Details for d2dpka1
PDB Entry: 2dpk (more details), 2.5 Å
PDB Description: The Crystal Structure of the Primary Ca2+ Sensor of the Na+/Ca2+ Exchanger
PDB Compounds: (A:) Sodium/calcium exchanger 1SCOPe Domain Sequences for d2dpka1:
Sequence, based on SEQRES records: (download)
>d2dpka1 b.1.27.1 (A:370-502) Sodium/calcium exchanger 1 {Dog (Canis familiaris) [TaxId: 9615]}
pvskiffeqgtyqclencgtvaltiirrggdltntvfvdfrtedgtanagsdyeftegtv
vfkpgetqkeirvgiidddifeedenflvhlsnvkvsseasedgileanhvsalaclgsp
statvtifdddha
Sequence, based on observed residues (ATOM records): (download)
>d2dpka1 b.1.27.1 (A:370-502) Sodium/calcium exchanger 1 {Dog (Canis familiaris) [TaxId: 9615]}
pvskiffeqgtyqclencgtvaltiirrggdltntvfvdfrtedgtanagsdyeftegtv
vfkpgetqkeirvgiidddifeedenflvhlsnvkvssesalaclgspstatvtifdddh
a
SCOPe Domain Coordinates for d2dpka1:
Click to download the PDB-style file with coordinates for d2dpka1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2dpka1:
- d2dpka1 first appeared in SCOP 1.73
- d2dpka1 appears in SCOPe 2.06
- d2dpka1 appears in the current release, SCOPe 2.08
View in 3D
