Lineage for d2dnva1 (2dnv A:8-58)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2785033Superfamily b.34.13: Chromo domain-like [54160] (4 families) (S)
    SH3-like barrel is capped by a C-terminal helix
  5. 2785079Family b.34.13.2: Chromo domain [54165] (8 proteins)
    lacks the SH3-like barrel first strand that can be complemented by bound peptide ligand; in shadow chromo domain the corresponding site is altered by insertion; similarity to the IL8-like fold
  6. 2785110Protein Chromobox protein homolog 8 [141214] (1 species)
    Polycomb 3 homolog, Pc3
  7. 2785111Species Mouse (Mus musculus) [TaxId:10090] [141215] (1 PDB entry)
    Uniprot Q9QXV1 7-58
  8. 2785112Domain d2dnva1: 2dnv A:8-58 [131594]
    Other proteins in same PDB: d2dnva2, d2dnva3

Details for d2dnva1

PDB Entry: 2dnv (more details)

PDB Description: solution structure of rsgi ruh-055, a chromo domain from mus musculus cdna
PDB Compounds: (A:) Chromobox protein homolog 8

SCOPe Domain Sequences for d2dnva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dnva1 b.34.13.2 (A:8-58) Chromobox protein homolog 8 {Mouse (Mus musculus) [TaxId: 10090]}
ervfaaeallkrrirkgrmeylvkwkgwsqkystwepeenildarllaafe

SCOPe Domain Coordinates for d2dnva1:

Click to download the PDB-style file with coordinates for d2dnva1.
(The format of our PDB-style files is described here.)

Timeline for d2dnva1: