Lineage for d2dmza1 (2dmz A:8-123)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. Family b.36.1.0: automated matches [191362] (1 protein)
    not a true family
  6. Protein automated matches [190436] (9 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187333] (104 PDB entries)
  8. Domain d2dmza1: 2dmz A:8-123 [264260]
    Other proteins in same PDB: d2dmza2, d2dmza3
    automated match to d1uewa_

Details for d2dmza1

PDB Entry: 2dmz (more details)

PDB Description: Solution structure of the third PDZ domain of human InaD-like protein
PDB Compounds: (A:) InaD-like protein

SCOPe Domain Sequences for d2dmza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dmza1 b.36.1.0 (A:8-123) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gsdsslfetynvelvrkdgqslgirivgyvgtshtgeasgiyvksvipgsaayhnghiqv
ndkivavdgvniqgfanhdvvevlrnagqvvhltlvrrktssstspleppsdrgtv

SCOPe Domain Coordinates for d2dmza1 are not available.

Timeline for d2dmza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2dmza2, d2dmza3