Class b: All beta proteins [48724] (176 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) |
Family b.34.2.1: SH3-domain [50045] (40 proteins) |
Protein p67phox [74922] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [74923] (2 PDB entries) |
Domain d2dmoa_: 2dmo A: [241611] automated match to d1ue9a_ |
PDB Entry: 2dmo (more details)
SCOPe Domain Sequences for d2dmoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dmoa_ b.34.2.1 (A:) p67phox {Human (Homo sapiens) [TaxId: 9606]} gssgssgeahrvlfgfvpetkeelqvmpgnivfvlkkgndnwatvmfngqkglvpcnyle pvsgpssg
Timeline for d2dmoa_: