Lineage for d2dm9a1 (2dm9 A:81-198)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
Superfamily d.81.4: V-type ATPase subunit E-like [160527] (1 family) 
extra N-terminal helix and extra C-terminal helix form dimerisation subdomainFamily d.81.4.1: V-type ATPase subunit E C-terminal domain [160528] (1 protein)
Pfam PF01991Protein V-type ATPase subunit E C-terminal domain [160529] (3 species) Species Pyrococcus horikoshii [TaxId:53953] [160530] (2 PDB entries)
Uniprot O57724 81-198
Domain d2dm9a1: 2dm9 A:81-198 [146544]
Details for d2dm9a1
PDB Entry: 2dm9 (more details), 1.85 Å
PDB Description: Crystal Structure of PH1978 from Pyrococcus horikoshii OT3
PDB Compounds: (A:) V-type ATP synthase subunit ESCOPe Domain Sequences for d2dm9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dm9a1 d.81.4.1 (A:81-198) V-type ATPase subunit E C-terminal domain {Pyrococcus horikoshii [TaxId: 53953]}
eiissvleevkrrletmsedeyfesvkallkeaikelnekkvrvmsnektlgliasriee
ikselgdvsielgetvdtmggvivetedgriridntfearmerfegeirstiakvlfg
SCOPe Domain Coordinates for d2dm9a1:
Click to download the PDB-style file with coordinates for d2dm9a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2dm9a1:
- d2dm9a1 first appeared in SCOP 1.75
- d2dm9a1 appears in SCOPe 2.07
View in 3D
