Lineage for d2dlsa1 (2dls A:8-87)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. Family b.36.1.0: automated matches [191362] (1 protein)
    not a true family
  6. Protein automated matches [190436] (9 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187333] (104 PDB entries)
  8. Domain d2dlsa1: 2dls A:8-87 [241597]
    Other proteins in same PDB: d2dlsa2, d2dlsa3
    automated match to d3qdoa_

Details for d2dlsa1

PDB Entry: 2dls (more details)

PDB Description: Solution structure of the PDZ domain of human Rho guanine nucleotide exchange factor 11
PDB Compounds: (A:) Rho guanine nucleotide exchange factor 11

SCOPe Domain Sequences for d2dlsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dlsa1 b.36.1.0 (A:8-87) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqrcviiqkdqhgfgftvsgdrivlvqsvrpggaamkagvkegdriikvngtmvtnsshl
evvkliksgayvaltllgss

SCOPe Domain Coordinates for d2dlsa1 are not available.

Timeline for d2dlsa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2dlsa2, d2dlsa3