Class b: All beta proteins [48724] (180 folds) |
Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
Superfamily b.36.1: PDZ domain-like [50156] (7 families) peptide-binding domain |
Family b.36.1.0: automated matches [191362] (1 protein) not a true family |
Protein automated matches [190436] (9 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187333] (104 PDB entries) |
Domain d2dlsa1: 2dls A:8-87 [241597] Other proteins in same PDB: d2dlsa2, d2dlsa3 automated match to d3qdoa_ |
PDB Entry: 2dls (more details)
SCOPe Domain Sequences for d2dlsa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dlsa1 b.36.1.0 (A:8-87) automated matches {Human (Homo sapiens) [TaxId: 9606]} vqrcviiqkdqhgfgftvsgdrivlvqsvrpggaamkagvkegdriikvngtmvtnsshl evvkliksgayvaltllgss
Timeline for d2dlsa1: