Lineage for d2dlba1 (2dlb A:2002-2071)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2434384Fold b.174: YopT-like [159221] (1 superfamily)
    beta-sheet barrel, closed, n=6, S=12, capped at both ends by helices; intertwined dimer of beta-alpha-beta(2) subinits;
  4. 2434385Superfamily b.174.1: YopT-like [159222] (1 family) (S)
    automatically mapped to Pfam PF09467
  5. 2434386Family b.174.1.1: YopT-like [159223] (2 proteins)
    Pfam PF09467
  6. 2434387Protein Uncharacterized protein YopT [159224] (1 species)
    probably of phage origin
  7. 2434388Species Bacillus subtilis [TaxId:1423] [159225] (1 PDB entry)
    Uniprot O34498 2-71
  8. 2434389Domain d2dlba1: 2dlb A:2002-2071 [146541]
    Other proteins in same PDB: d2dlbb_

Details for d2dlba1

PDB Entry: 2dlb (more details), 1.2 Å

PDB Description: X-ray Crystal Structure of Protein yopT from Bacillus subtilis. Northeast Structural Genomics Consortium Target SR412
PDB Compounds: (A:) yopT

SCOPe Domain Sequences for d2dlba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dlba1 b.174.1.1 (A:2002-2071) Uncharacterized protein YopT {Bacillus subtilis [TaxId: 1423]}
agylnnialnleivlknkadspevsetlvtricenlllskevsflkadgsvenfklsdme
yeitnteelp

SCOPe Domain Coordinates for d2dlba1:

Click to download the PDB-style file with coordinates for d2dlba1.
(The format of our PDB-style files is described here.)

Timeline for d2dlba1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2dlbb_