Lineage for d2dl2a1 (2dl2 A:4-101)
- Root: SCOPe 2.03
Class b: All beta proteins [48724] (174 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.4: I set domains [49159] (39 proteins) 
Protein Killer cell inhibitory receptor [49202] (4 species)
possibly an intermediate structure between the I set and FnIII domains
Species Human (Homo sapiens), 2dl2 [TaxId:9606] [49205] (2 PDB entries) 
Domain d2dl2a1: 2dl2 A:4-101 [21803]
Details for d2dl2a1
PDB Entry: 2dl2 (more details), 3 Å
PDB Description: killer immunoglobulin receptor 2dl2
PDB Compounds: (A:) protein (MHC class I nk cell receptor precursor (p58 natural killer cell receptor clone cl-43))SCOPe Domain Sequences for d2dl2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dl2a1 b.1.1.4 (A:4-101) Killer cell inhibitory receptor {Human (Homo sapiens), 2dl2 [TaxId: 9606]}
ahrkpsllahpgrlvkseetvilqcwsdvrfehfllhregkfkdtlhligehhdgvskan
fsigpmmqdlagtyrcygsvthspyqlsapsdpldivi
SCOPe Domain Coordinates for d2dl2a1:
Click to download the PDB-style file with coordinates for d2dl2a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2dl2a1:
- d2dl2a1 first appeared (with stable ids) in SCOP 1.55
- d2dl2a1 appears in SCOPe 2.02
- d2dl2a1 appears in SCOPe 2.04
- d2dl2a1 appears in the current release, SCOPe 2.08
View in 3D
