Lineage for d2djsa1 (2djs A:8-102)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2035676Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2035677Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2035749Protein Ephrin type-B receptor 1 [141035] (1 species)
  7. 2035750Species Human (Homo sapiens) [TaxId:9606] [141036] (1 PDB entry)
    Uniprot P54762 434-528
  8. 2035751Domain d2djsa1: 2djs A:8-102 [131549]
    Other proteins in same PDB: d2djsa2, d2djsa3

Details for d2djsa1

PDB Entry: 2djs (more details)

PDB Description: solution structures of the fn3 domain of human ephrin type-b receptor 1
PDB Compounds: (A:) Ephrin type-B receptor 1

SCOPe Domain Sequences for d2djsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]}
pstvpimhqvsatmrsitlswpqpeqpngiildyeiryyekehnefnssmarsqtntari
dglrpgmvyvvqvrartvagygkfsgkmcfqtltd

SCOPe Domain Coordinates for d2djsa1:

Click to download the PDB-style file with coordinates for d2djsa1.
(The format of our PDB-style files is described here.)

Timeline for d2djsa1: