Lineage for d2djka1 (2djk A:6-133)
- Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the restSuperfamily c.47.1: Thioredoxin-like [52833] (24 families) 
Family c.47.1.2: PDI-like [52849] (3 proteins)
duplication: contains two tandem repeats of this foldProtein Protein disulfide isomerase, PDI [52850] (5 species) 
Species Fungus (Humicola insolens) [TaxId:34413] [142357] (3 PDB entries)
Uniprot P55059 227-355! Uniprot P55059 350-459
Domain d2djka1: 2djk A:6-133 [131548]
Other proteins in same PDB: d2djka2
domain B' only, corresponds to the 3rd domain of yeast PDI (2B5E)
Details for d2djka1
PDB Entry: 2djk (more details)
PDB Description: solution structure of the b' domain of thermophilic fungal protein disulfide isomerase
PDB Compounds: (A:) Protein disulfide-isomeraseSCOPe Domain Sequences for d2djka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2djka1 c.47.1.2 (A:6-133) Protein disulfide isomerase, PDI {Fungus (Humicola insolens) [TaxId: 34413]}
pligeigpetysdymsagiplayifaetaeerkelsdklkpiaeaqrgvinfgtidakaf
gahagnlnlktdkfpafaiqevaknqkfpfdqekeitfeaikafvddfvagkiepsikse
pipekqeg
SCOPe Domain Coordinates for d2djka1:
Click to download the PDB-style file with coordinates for d2djka1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2djka1:
- d2djka1 first appeared in SCOP 1.73
- d2djka1 appears in SCOPe 2.05
- d2djka1 appears in SCOPe 2.07
- d2djka1 appears in the current release, SCOPe 2.08
View in 3D
