Lineage for d2dj8a1 (2dj8 A:8-54)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1707967Fold g.85: HIT/MYND zinc finger-like [144231] (1 superfamily)
    dimetal(zinc)-bound alpha+beta fold; structural similarity to members of the Cysteine-rich domain fold (57888)
  4. 1707968Superfamily g.85.1: HIT/MYND zinc finger-like [144232] (2 families) (S)
  5. 1707969Family g.85.1.1: MYND zinc finger [144233] (4 proteins)
    Pfam PF01753
  6. 1707978Protein Zinc finger MYND domain-containing protein 2, MTG8 [144238] (1 species)
    Protein CBFA2T1
  7. 1707979Species Human (Homo sapiens) [TaxId:9606] [144239] (1 PDB entry)
    Uniprot Q06455 505-551
    1499
  8. 1707980Domain d2dj8a1: 2dj8 A:8-54 [131540]
    complexed with zn

Details for d2dj8a1

PDB Entry: 2dj8 (more details)

PDB Description: solution structure of zf-mynd domain of protein cbfa2ti (protein mtg8)
PDB Compounds: (A:) Protein CBFA2T1

SCOPe Domain Sequences for d2dj8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dj8a1 g.85.1.1 (A:8-54) Zinc finger MYND domain-containing protein 2, MTG8 {Human (Homo sapiens) [TaxId: 9606]}
inqqedssescwncgrkasetcsgcntarycgsfcqhkdwekhhhic

SCOPe Domain Coordinates for d2dj8a1:

Click to download the PDB-style file with coordinates for d2dj8a1.
(The format of our PDB-style files is described here.)

Timeline for d2dj8a1: