Class g: Small proteins [56992] (91 folds) |
Fold g.85: HIT/MYND zinc finger-like [144231] (1 superfamily) dimetal(zinc)-bound alpha+beta fold; structural similarity to members of the Cysteine-rich domain fold (57888) |
Superfamily g.85.1: HIT/MYND zinc finger-like [144232] (2 families) |
Family g.85.1.1: MYND zinc finger [144233] (4 proteins) Pfam PF01753 |
Protein Zinc finger MYND domain-containing protein 2, MTG8 [144238] (1 species) Protein CBFA2T1 |
Species Human (Homo sapiens) [TaxId:9606] [144239] (1 PDB entry) Uniprot Q06455 505-551 1499 |
Domain d2dj8a1: 2dj8 A:8-54 [131540] complexed with zn |
PDB Entry: 2dj8 (more details)
SCOPe Domain Sequences for d2dj8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dj8a1 g.85.1.1 (A:8-54) Zinc finger MYND domain-containing protein 2, MTG8 {Human (Homo sapiens) [TaxId: 9606]} inqqedssescwncgrkasetcsgcntarycgsfcqhkdwekhhhic
Timeline for d2dj8a1: