Lineage for d2diqa1 (2diq A:8-104)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2394116Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) (S)
  5. 2394117Family b.34.9.1: Tudor domain [63749] (8 proteins)
    Pfam PF00567
  6. 2394261Protein Tudor and KH domain-containing protein TDRKH [141205] (1 species)
  7. 2394262Species Human (Homo sapiens) [TaxId:9606] [141206] (2 PDB entries)
    Uniprot Q9Y2W6 329-425
  8. 2394264Domain d2diqa1: 2diq A:8-104 [131531]
    Other proteins in same PDB: d2diqa2, d2diqa3

Details for d2diqa1

PDB Entry: 2diq (more details)

PDB Description: solution structure of the tudor domain of tudor and kh domain containing protein
PDB Compounds: (A:) Tudor and KH domain-containing protein

SCOPe Domain Sequences for d2diqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2diqa1 b.34.9.1 (A:8-104) Tudor and KH domain-containing protein TDRKH {Human (Homo sapiens) [TaxId: 9606]}
rslqldklvnemtqhyensvpedltvhvgdivaaplptngswyrarvlgtlengnldlyf
vdfgdngdcplkdlralrsdflslpfqaiecslaria

SCOPe Domain Coordinates for d2diqa1:

Click to download the PDB-style file with coordinates for d2diqa1.
(The format of our PDB-style files is described here.)

Timeline for d2diqa1: