Class b: All beta proteins [48724] (178 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) |
Family b.34.9.1: Tudor domain [63749] (8 proteins) Pfam PF00567 |
Protein Tudor and KH domain-containing protein TDRKH [141205] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [141206] (2 PDB entries) Uniprot Q9Y2W6 329-425 |
Domain d2diqa1: 2diq A:8-104 [131531] Other proteins in same PDB: d2diqa2, d2diqa3 |
PDB Entry: 2diq (more details)
SCOPe Domain Sequences for d2diqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2diqa1 b.34.9.1 (A:8-104) Tudor and KH domain-containing protein TDRKH {Human (Homo sapiens) [TaxId: 9606]} rslqldklvnemtqhyensvpedltvhvgdivaaplptngswyrarvlgtlengnldlyf vdfgdngdcplkdlralrsdflslpfqaiecslaria
Timeline for d2diqa1: