Lineage for d2dica1 (2dic A:8-105)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1770169Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1770776Family b.1.18.10: Filamin repeat (rod domain) [81290] (5 proteins)
    Pfam PF00630
  6. 1770798Protein Filamin b [141025] (1 species)
  7. 1770799Species Human (Homo sapiens) [TaxId:9606] [141026] (17 PDB entries)
    Uniprot O75369 1017-1134! Uniprot O75369 1130-1229! Uniprot O75369 1215-1329! Uniprot O75369 1325-1442! Uniprot O75369 1418-1518! Uniprot O75369 1611-1721! Uniprot O75369 1899-2001! Uniprot O75369 1999-2096! Uniprot O75369 2104-2192
  8. 1770805Domain d2dica1: 2dic A:8-105 [131528]
    12th repeat

Details for d2dica1

PDB Entry: 2dic (more details)

PDB Description: solution structure of the 12th filamin domain from human filamin-b
PDB Compounds: (A:) Filamin-B

SCOPe Domain Sequences for d2dica1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dica1 b.1.18.10 (A:8-105) Filamin b {Human (Homo sapiens) [TaxId: 9606]}
gcqpsrvqaqgpglkeaftnkpnvftvvtrgagigglgitvegpseskincrdnkdgscs
aeyipfapgdydvnityggahipgspfrvpvkdvvdps

SCOPe Domain Coordinates for d2dica1:

Click to download the PDB-style file with coordinates for d2dica1.
(The format of our PDB-style files is described here.)

Timeline for d2dica1: