Lineage for d2dgza1 (2dgz A:1140-1239)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 916790Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 917285Superfamily a.60.8: HRDC-like [47819] (4 families) (S)
  5. 917286Family a.60.8.1: HRDC domain from helicases [47820] (3 proteins)
  6. 917292Protein Werner syndrome ATP-dependent helicase, WRN [140640] (1 species)
  7. 917293Species Human (Homo sapiens) [TaxId:9606] [140641] (2 PDB entries)
    Uniprot Q14191 1140-1239! Uniprot Q14191 1142-1235
  8. 917295Domain d2dgza1: 2dgz A:1140-1239 [131516]

Details for d2dgza1

PDB Entry: 2dgz (more details)

PDB Description: solution structure of the helicase and rnase d c-terminal domain in werner syndrome atp-dependent helicase
PDB Compounds: (A:) Werner syndrome protein variant

SCOPe Domain Sequences for d2dgza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dgza1 a.60.8.1 (A:1140-1239) Werner syndrome ATP-dependent helicase, WRN {Human (Homo sapiens) [TaxId: 9606]}
ssqpvisaqeqetqivlygklvearqkhankmdvppailatnkilvdmakmrpttvenvk
ridgvsegkaamlaplwevikhfcqtnsvqtdlfsstkpq

SCOPe Domain Coordinates for d2dgza1:

Click to download the PDB-style file with coordinates for d2dgza1.
(The format of our PDB-style files is described here.)

Timeline for d2dgza1: