Lineage for d2dgza1 (2dgz A:1140-1239)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. Superfamily a.60.8: HRDC-like [47819] (5 families) (S)
  5. Family a.60.8.1: HRDC domain from helicases [47820] (3 proteins)
  6. Protein Werner syndrome ATP-dependent helicase, WRN [140640] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [140641] (2 PDB entries)
    Uniprot Q14191 1140-1239! Uniprot Q14191 1142-1235
  8. Domain d2dgza1: 2dgz A:1140-1239 [131516]
    Other proteins in same PDB: d2dgza2, d2dgza3

Details for d2dgza1

PDB Entry: 2dgz (more details)

PDB Description: Solution structure of the Helicase and RNase D C-terminal domain in Werner syndrome ATP-dependent helicase
PDB Compounds: (A:) Werner syndrome protein variant

SCOPe Domain Sequences for d2dgza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dgza1 a.60.8.1 (A:1140-1239) Werner syndrome ATP-dependent helicase, WRN {Human (Homo sapiens) [TaxId: 9606]}
ssqpvisaqeqetqivlygklvearqkhankmdvppailatnkilvdmakmrpttvenvk
ridgvsegkaamlaplwevikhfcqtnsvqtdlfsstkpq

SCOPe Domain Coordinates for d2dgza1 are not available.

Timeline for d2dgza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2dgza2, d2dgza3