Lineage for d2dg0a1 (2dg0 A:5-324)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
consists of six 4-stranded beta-sheet motifs; meanderSuperfamily b.68.6: Calcium-dependent phosphotriesterase [63829] (4 families) 
Family b.68.6.1: SGL-like [63830] (4 proteins) 
Protein Lactonase Drp35 [141546] (1 species) Species Staphylococcus aureus [TaxId:1280] [141547] (2 PDB entries)
Uniprot Q7A338 5-324! Uniprot Q99QV3 5-324
Domain d2dg0a1: 2dg0 A:5-324 [131481]
Other proteins in same PDB: d2dg0a2, d2dg0b_, d2dg0c_, d2dg0d_, d2dg0e2, d2dg0e3, d2dg0f_, d2dg0g_, d2dg0h_, d2dg0i_, d2dg0j2, d2dg0j3, d2dg0k_, d2dg0l_
Details for d2dg0a1
PDB Entry: 2dg0 (more details), 2.4 Å
PDB Description: Crystal structure of Drp35, a 35kDa drug responsive protein from Staphylococcus aureus
PDB Compounds: (A:) DrP35SCOPe Domain Sequences for d2dg0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dg0a1 b.68.6.1 (A:5-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]}
qqdlptlfysgksnsavpiiseselqtitaepwleiskkglqleglnfdrqgqlflldvf
egnifkinpetkeikrpfvshkanpaaikihkdgrlfvcylgdfkstggifaatengdnl
qdiiedlstayciddmvfdskggfyftdfrgystnplggvyyvspdfrtvtpiiqnisva
ngialstdekvlwvtettanrlhrialeddgvtiqpfgatipyyftghegpdsccidsdd
nlyvamygqgrvlvfnkrgypigqilipgrdeghmlrsthpqfipgtnqliicsndiemg
ggsmlytvngfakghqsfqf
SCOPe Domain Coordinates for d2dg0a1:
Click to download the PDB-style file with coordinates for d2dg0a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2dg0a1:
- d2dg0a1 first appeared in SCOP 1.73
- d2dg0a1 appears in SCOPe 2.06
- d2dg0a1 appears in the current release, SCOPe 2.08
View in 3D
