Lineage for d2dfka1 (2dfk A:37-239)
- Root: SCOPe 2.07
Class a: All alpha proteins [46456] (289 folds) 
Fold a.87: DBL homology domain (DH-domain) [48064] (1 superfamily)
multihelical; core: 5-helical bundleSuperfamily a.87.1: DBL homology domain (DH-domain) [48065] (2 families) 
automatically mapped to Pfam PF00621Family a.87.1.1: DBL homology domain (DH-domain) [48066] (10 proteins)
Pfam PF00621
Protein Rho guanine nucleotide exchange factor 9, Collybistin [158679] (1 species) Species Norway rat (Rattus norvegicus) [TaxId:10116] [158680] (1 PDB entry)
Uniprot Q9QX73 97-299
Domain d2dfka1: 2dfk A:37-239 [145077]
Other proteins in same PDB: d2dfka2, d2dfkb_, d2dfkc2, d2dfkd2, d2dfkd3
complexed with gol, so4
Details for d2dfka1
PDB Entry: 2dfk (more details), 2.15 Å
PDB Description: Crystal structure of the CDC42-Collybistin II complex
PDB Compounds: (A:) collybistin IISCOPe Domain Sequences for d2dfka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dfka1 a.87.1.1 (A:37-239) Rho guanine nucleotide exchange factor 9, Collybistin {Norway rat (Rattus norvegicus) [TaxId: 10116]}
clclgrplqnrdqmranvineimsterhyikhlkdicegylkqcrkrrdmfsdeqlkvif
gniediyrfqmgfvrdlekqynnddphlseigpcflehqdgfwiyseycnnhldacmels
klmkdsryqhffeacrllqqmidiaidgflltpvqkickyplqlaellkytaqdhsdyry
vaaalavmrnvtqqinerkrrle
SCOPe Domain Coordinates for d2dfka1:
Click to download the PDB-style file with coordinates for d2dfka1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2dfka1:
- d2dfka1 first appeared in SCOP 1.75
- d2dfka1 appears in SCOPe 2.06
- d2dfka1 appears in the current release, SCOPe 2.08
View in 3D
