Lineage for d2dexx2 (2dex X:4-112)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2043106Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2043107Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2044656Family b.6.1.6: Peptidylarginine deiminase Pad4, N-terminal domain [110107] (1 protein)
    probably related to cupredoxins but lacking the metal-binding site
    automatically mapped to Pfam PF08526
  6. 2044657Protein Peptidylarginine deiminase Pad4, N-terminal domain [110108] (1 species)
  7. 2044658Species Human (Homo sapiens) [TaxId:9606] [110109] (16 PDB entries)
    Uniprot Q9UM07
  8. 2044659Domain d2dexx2: 2dex X:4-112 [131437]
    Other proteins in same PDB: d2dexx1, d2dexx3
    automatically matched to d1wd8a2
    complexed with ca, so4

Details for d2dexx2

PDB Entry: 2dex (more details), 2.1 Å

PDB Description: crystal structure of human peptidylarginine deiminase 4 in complex with histone h3 n-terminal peptide including arg17
PDB Compounds: (X:) Protein-arginine deiminase type IV

SCOPe Domain Sequences for d2dexx2:

Sequence, based on SEQRES records: (download)

>d2dexx2 b.6.1.6 (X:4-112) Peptidylarginine deiminase Pad4, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
gtlirvtpeqpthavcvlgtltqldicssapedctsfsinaspgvvvdiahsppakkkst
gsstwpldpgvevtltmkaasgstgdqkvqisyygpktppvkallylta

Sequence, based on observed residues (ATOM records): (download)

>d2dexx2 b.6.1.6 (X:4-112) Peptidylarginine deiminase Pad4, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
gtlirvtpeqpthavcvlgtltqldicssaptsfsinaspgvvvditwpldpgvevtltm
kaasgstgdqkvqisyygpktppvkallylta

SCOPe Domain Coordinates for d2dexx2:

Click to download the PDB-style file with coordinates for d2dexx2.
(The format of our PDB-style files is described here.)

Timeline for d2dexx2: