| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) ![]() |
| Family d.22.1.0: automated matches [191400] (1 protein) not a true family |
| Protein automated matches [190526] (26 species) not a true protein |
| Species Favia favus [TaxId:102203] [188529] (4 PDB entries) |
| Domain d2dddb_: 2ddd B: [163614] automated match to d1mova_ complexed with mg, na |
PDB Entry: 2ddd (more details), 1.55 Å
SCOPe Domain Sequences for d2dddb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dddb_ d.22.1.0 (B:) automated matches {Favia favus [TaxId: 102203]}
vsvitsemkievrmegavnghkfvitgkgsgqpfegiqnvdltvieggplpfafdiltta
fhygnrvfvkypeeivdyfkqsfpegyswersmsyedggiclatnnitmkkdgsncfvne
irfdgvnfpangpvmqrktvkwesstekmyvrdgvlkgdvnmalllqggghyrcdfrtty
kakkvvqlpdyhfvdhlmeitshdkdynkvklyehakahsglprlak
Timeline for d2dddb_: