Lineage for d2dddb_ (2ddd B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2939772Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2939773Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2940626Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 2940627Protein automated matches [190526] (26 species)
    not a true protein
  7. 2940985Species Favia favus [TaxId:102203] [188529] (4 PDB entries)
  8. 2940987Domain d2dddb_: 2ddd B: [163614]
    automated match to d1mova_
    complexed with mg, na

Details for d2dddb_

PDB Entry: 2ddd (more details), 1.55 Å

PDB Description: Unique behavior of a histidine responsible for an engineered green-to-red photoconversion process
PDB Compounds: (B:) photoconvertible fluorescent protein

SCOPe Domain Sequences for d2dddb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dddb_ d.22.1.0 (B:) automated matches {Favia favus [TaxId: 102203]}
vsvitsemkievrmegavnghkfvitgkgsgqpfegiqnvdltvieggplpfafdiltta
fhygnrvfvkypeeivdyfkqsfpegyswersmsyedggiclatnnitmkkdgsncfvne
irfdgvnfpangpvmqrktvkwesstekmyvrdgvlkgdvnmalllqggghyrcdfrtty
kakkvvqlpdyhfvdhlmeitshdkdynkvklyehakahsglprlak

SCOPe Domain Coordinates for d2dddb_:

Click to download the PDB-style file with coordinates for d2dddb_.
(The format of our PDB-style files is described here.)

Timeline for d2dddb_: