Lineage for d2dddb_ (2ddd B:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.22: GFP-like [54510] (1 superfamily)
beta-sheet folds into a barrel (n=11, S=14) around the central helixSuperfamily d.22.1: GFP-like [54511] (3 families) 
Family d.22.1.0: automated matches [191400] (1 protein)
not a true familyProtein automated matches [190526] (26 species)
not a true protein
Species Favia favus [TaxId:102203] [188529] (4 PDB entries) 
Domain d2dddb_: 2ddd B: [163614]
automated match to d1mova_
complexed with mg, na
Details for d2dddb_
PDB Entry: 2ddd (more details), 1.55 Å
PDB Description: Unique behavior of a histidine responsible for an engineered green-to-red photoconversion process
PDB Compounds: (B:) photoconvertible fluorescent proteinSCOPe Domain Sequences for d2dddb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dddb_ d.22.1.0 (B:) automated matches {Favia favus [TaxId: 102203]}
vsvitsemkievrmegavnghkfvitgkgsgqpfegiqnvdltvieggplpfafdiltta
fhygnrvfvkypeeivdyfkqsfpegyswersmsyedggiclatnnitmkkdgsncfvne
irfdgvnfpangpvmqrktvkwesstekmyvrdgvlkgdvnmalllqggghyrcdfrtty
kakkvvqlpdyhfvdhlmeitshdkdynkvklyehakahsglprlak
SCOPe Domain Coordinates for d2dddb_:
Click to download the PDB-style file with coordinates for d2dddb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2dddb_:
- d2dddb_ first appeared in SCOPe 2.01
- d2dddb_ appears in SCOPe 2.07
View in 3D
