Lineage for d2db7a1 (2db7 A:3-57)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2738899Fold a.273: Orange domain-like [158456] (1 superfamily)
    4 helices; dimer of identical alpha-hairpin subunits;
  4. 2738900Superfamily a.273.1: Orange domain-like [158457] (1 family) (S)
  5. 2738901Family a.273.1.1: Hairy Orange domain [158458] (2 proteins)
    Pfam PF07527
  6. 2738902Protein Hairy/enhancer-of-split related with YRPW motif protein 1; HESR-1 [158459] (1 species)
  7. 2738903Species Human (Homo sapiens) [TaxId:9606] [158460] (1 PDB entry)
    Uniprot Q9Y5J3 111-165
  8. 2738904Domain d2db7a1: 2db7 A:3-57 [146480]
    Other proteins in same PDB: d2db7a2, d2db7b2, d2db7b3

Details for d2db7a1

PDB Entry: 2db7 (more details), 1.9 Å

PDB Description: Crystal structure of hypothetical protein MS0332
PDB Compounds: (A:) Hairy/enhancer-of-split related with YRPW motif 1

SCOPe Domain Sequences for d2db7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2db7a1 a.273.1.1 (A:3-57) Hairy/enhancer-of-split related with YRPW motif protein 1; HESR-1 {Human (Homo sapiens) [TaxId: 9606]}
gyfdahalamdyrslgfreclaevarylsiiegldasdplrvrlvshlnnyasqr

SCOPe Domain Coordinates for d2db7a1:

Click to download the PDB-style file with coordinates for d2db7a1.
(The format of our PDB-style files is described here.)

Timeline for d2db7a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2db7a2