| Class b: All beta proteins [48724] (180 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) ![]() |
| Family b.34.9.1: Tudor domain [63749] (9 proteins) Pfam PF00567 |
| Protein Tudor domain-containing protein 3, TDRD3 [141201] (2 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [141202] (1 PDB entry) Uniprot Q91W18 553-612 |
| Domain d2d9ta1: 2d9t A:8-67 [131351] Other proteins in same PDB: d2d9ta2, d2d9ta3 |
PDB Entry: 2d9t (more details)
SCOPe Domain Sequences for d2d9ta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d9ta1 b.34.9.1 (A:8-67) Tudor domain-containing protein 3, TDRD3 {Mouse (Mus musculus) [TaxId: 10090]}
kvwkpgdecfalywednkfyraevealhssgmtavvkftdygnyeevllsnikpvqteaw
Timeline for d2d9ta1: