Lineage for d2d92a1 (2d92 A:8-102)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. Family b.36.1.0: automated matches [191362] (1 protein)
    not a true family
  6. Protein automated matches [190436] (9 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187333] (104 PDB entries)
  8. Domain d2d92a1: 2d92 A:8-102 [241518]
    Other proteins in same PDB: d2d92a2, d2d92a3
    automated match to d1wfva_

Details for d2d92a1

PDB Entry: 2d92 (more details)

PDB Description: Solution structure of the fifth PDZ domain of InaD-like protein
PDB Compounds: (A:) InaD-like protein

SCOPe Domain Sequences for d2d92a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d92a1 b.36.1.0 (A:8-102) automated matches {Human (Homo sapiens) [TaxId: 9606]}
elalwspevkivelvkdckglgfsildyqdpldptrsvivirslvadgvaersggllpgd
rlvsvneycldntslaeaveilkavppglvhlgic

SCOPe Domain Coordinates for d2d92a1 are not available.

Timeline for d2d92a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2d92a2, d2d92a3