Class g: Small proteins [56992] (91 folds) |
Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) |
Family g.39.1.3: LIM domain [57736] (18 proteins) duplication: contains two (sub)domains of this fold |
Protein Eplin, LIMA1 [144165] (1 species) Epithelial protein lost in neoplasm |
Species Human (Homo sapiens) [TaxId:9606] [144166] (1 PDB entry) Uniprot Q9UHB6 381-417! Uniprot Q9UHB6 416-457 |
Domain d2d8ya2: 2d8y A:44-85 [131340] complexed with zn |
PDB Entry: 2d8y (more details)
SCOPe Domain Sequences for d2d8ya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d8ya2 g.39.1.3 (A:44-85) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} rcsycnnklslgtyaslhgriyckphfnqlfkskgnydegfg
Timeline for d2d8ya2: