Lineage for d2d8ya2 (2d8y A:44-85)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1705142Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 1705143Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 1705281Family g.39.1.3: LIM domain [57736] (18 proteins)
    duplication: contains two (sub)domains of this fold
  6. 1705315Protein Eplin, LIMA1 [144165] (1 species)
    Epithelial protein lost in neoplasm
  7. 1705316Species Human (Homo sapiens) [TaxId:9606] [144166] (1 PDB entry)
    Uniprot Q9UHB6 381-417! Uniprot Q9UHB6 416-457
  8. 1705318Domain d2d8ya2: 2d8y A:44-85 [131340]
    complexed with zn

Details for d2d8ya2

PDB Entry: 2d8y (more details)

PDB Description: solution structure of the lim domain of epithelial protein lost in neoplasm
PDB Compounds: (A:) EPLIN protein

SCOPe Domain Sequences for d2d8ya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d8ya2 g.39.1.3 (A:44-85) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]}
rcsycnnklslgtyaslhgriyckphfnqlfkskgnydegfg

SCOPe Domain Coordinates for d2d8ya2:

Click to download the PDB-style file with coordinates for d2d8ya2.
(The format of our PDB-style files is described here.)

Timeline for d2d8ya2:

1705318
d2d8ya2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d2d8ya1