Lineage for d2d8da1 (2d8d A:3-82)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.130: Chorismate mutase II [48599] (1 superfamily)
multihelical; core: 6 helices, bundleSuperfamily a.130.1: Chorismate mutase II [48600] (5 families) 
Family a.130.1.1: Dimeric chorismate mutase [48601] (4 proteins)
intertwined homodimer of 3-helical subunitsProtein Chorismate mutase domain of P-protein [48602] (2 species) Species Thermus thermophilus [TaxId:274] [140937] (2 PDB entries)
Uniprot Q5SLA5 3-82
Domain d2d8da1: 2d8d A:3-82 [131329]
complexed with cl
Details for d2d8da1
PDB Entry: 2d8d (more details), 1.15 Å
PDB Description: Structure of Chorismate Mutase (Form I) from Thermus Thermophilus HB8
PDB Compounds: (A:) phospho-2-dehydro-3-deoxyheptonate aldolase/chorismate mutaseSCOPe Domain Sequences for d2d8da1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d8da1 a.130.1.1 (A:3-82) Chorismate mutase domain of P-protein {Thermus thermophilus [TaxId: 274]}
eriqalrkevdrvnreilrllsergrlvqeigrlqtelglphydpkreeemlayltaenp
gpfpdetirklfkeifkasl
SCOPe Domain Coordinates for d2d8da1:
Click to download the PDB-style file with coordinates for d2d8da1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2d8da1:
- d2d8da1 first appeared in SCOP 1.73
- d2d8da1 appears in SCOPe 2.07
View in 3D
