Lineage for d2d7va1 (2d7v A:7-161)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.227: OsmC-like [82783] (1 superfamily)
swapped dimer of beta(3)-alpha-beta(2)-alpha(2)-beta subunits; mixed beta-sheet; order: 321[4][5][6]; buried helixSuperfamily d.227.1: OsmC-like [82784] (3 families) 
Family d.227.1.1: Ohr/OsmC resistance proteins [82785] (8 proteins) 
Protein Hypothetical protein VCA0330 [160787] (1 species) Species Vibrio cholerae [TaxId:666] [160788] (1 PDB entry)
Uniprot Q9KMK9 7-161
Domain d2d7va1: 2d7v A:7-161 [146468]
Details for d2d7va1
PDB Entry: 2d7v (more details), 1.97 Å
PDB Description: Structure of OsmC-like Protein of Unknown Function VCA0330 from Vibrio cholerae O1 biovar eltor str. N16961
PDB Compounds: (A:) Hypothetical protein VCA0330SCOPe Domain Sequences for d2d7va1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d7va1 d.227.1.1 (A:7-161) Hypothetical protein VCA0330 {Vibrio cholerae [TaxId: 666]}
smsehsaivtwkrkdseaftdnqysrahtwefdggskilasasphvvpvplsveanvdpe
eafvaalsschmlvflsiaakqrylvesytdnavgilgknskgktsvtkvvlrpqvvfsg
tskptlqqlekmhhlahencfiansvetevvteii
SCOPe Domain Coordinates for d2d7va1:
Click to download the PDB-style file with coordinates for d2d7va1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2d7va1:
- d2d7va1 first appeared in SCOP 1.75
- d2d7va1 appears in SCOPe 2.07
View in 3D
