Lineage for d2d7tl_ (2d7t L:)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) Protein automated matches [190119] (18 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [188740] (120 PDB entries) 
Domain d2d7tl_: 2d7t L: [203942]
Other proteins in same PDB: d2d7th_
automated match to d1fvcc_
Details for d2d7tl_
PDB Entry: 2d7t (more details), 1.7 Å
PDB Description: Crystal structure of human anti polyhydroxybutyrate antibody Fv
PDB Compounds: (L:) anti polyhydroxybutyrate antibody Fv, light chainSCOPe Domain Sequences for d2d7tl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d7tl_ b.1.1.1 (L:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divmtqspsslsasvgdrvtitcrasqninnylhwyqhepgkapklliyaasnlqggvts
rfsgsgsgtdftltistlqpedfatyyclqthaypltfgggtkvdikraa
SCOPe Domain Coordinates for d2d7tl_:
Click to download the PDB-style file with coordinates for d2d7tl_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2d7tl_:
- d2d7tl_ first appeared in SCOPe 2.03
- d2d7tl_ appears in SCOPe 2.04
- d2d7tl_ is called d2d7tl1 in SCOPe 2.06
- d2d7tl_ appears in the current release, SCOPe 2.08, called d2d7tl1
View in 3D
