Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.10: Filamin repeat (rod domain) [81290] (5 proteins) Pfam PF00630 |
Protein Filamin C [117049] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [117050] (6 PDB entries) Uniprot Q14315 2633-2725 |
Domain d2d7pa1: 2d7p A:8-106 [131324] Other proteins in same PDB: d2d7pa2, d2d7pa3 22nd repeat |
PDB Entry: 2d7p (more details)
SCOPe Domain Sequences for d2d7pa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d7pa1 b.1.18.10 (A:8-106) Filamin C {Human (Homo sapiens) [TaxId: 9606]} sddarrltvtslqetglkvnqpasfavqlngargvidarvhtpsgaveecyvseldsdkh tirfiphengvhsidvkfngahipgspfkirvgeqsqag
Timeline for d2d7pa1: