Lineage for d2d7pa1 (2d7p A:8-106)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2765751Family b.1.18.10: Filamin repeat (rod domain) [81290] (5 proteins)
    Pfam PF00630
  6. 2765798Protein Filamin C [117049] (1 species)
  7. 2765799Species Human (Homo sapiens) [TaxId:9606] [117050] (6 PDB entries)
    Uniprot Q14315 2633-2725
  8. 2765805Domain d2d7pa1: 2d7p A:8-106 [131324]
    Other proteins in same PDB: d2d7pa2, d2d7pa3
    22nd repeat

Details for d2d7pa1

PDB Entry: 2d7p (more details)

PDB Description: solution structure of the 22th filamin domain from human filamin c
PDB Compounds: (A:) Filamin-C

SCOPe Domain Sequences for d2d7pa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d7pa1 b.1.18.10 (A:8-106) Filamin C {Human (Homo sapiens) [TaxId: 9606]}
sddarrltvtslqetglkvnqpasfavqlngargvidarvhtpsgaveecyvseldsdkh
tirfiphengvhsidvkfngahipgspfkirvgeqsqag

SCOPe Domain Coordinates for d2d7pa1:

Click to download the PDB-style file with coordinates for d2d7pa1.
(The format of our PDB-style files is described here.)

Timeline for d2d7pa1: