Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) consists of one domain of this fold |
Family c.55.3.9: CAF1-like ribonuclease [102492] (3 proteins) |
Protein CCR4-NOT transcription complex subunit 7, CAF1 [159633] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [159634] (1 PDB entry) Uniprot Q9UIV1 11-262 |
Domain d2d5ra1: 2d5r A:11-262 [146466] Other proteins in same PDB: d2d5rb1, d2d5rb2 |
PDB Entry: 2d5r (more details), 2.5 Å
SCOPe Domain Sequences for d2d5ra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d5ra1 c.55.3.9 (A:11-262) CCR4-NOT transcription complex subunit 7, CAF1 {Human (Homo sapiens) [TaxId: 9606]} ricevwacnldeemkkirqvirkynyvamdtefpgvvarpigefrsnadyqyqllrcnvd llkiiqlgltfmneqgeyppgtstwqfnfkfnltedmyaqdsiellttsgiqfkkheeeg ietqyfaellmtsgvvlcegvkwlsfhsgydfgylikiltnsnlpeeeldffeilrlffp viydvkylmkscknlkgglqevaeqlelerigpqhqagsdslltgmaffkmremffedhi ddakycghlygl
Timeline for d2d5ra1: