Lineage for d2d5ba1 (2d5b A:349-500)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
core: 4 helices; bundle; one loop crosses over one side of the bundleSuperfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families) 
Family a.27.1.0: automated matches [227164] (1 protein)
not a true familyProtein automated matches [226872] (13 species)
not a true proteinSpecies Thermus thermophilus [TaxId:274] [254947] (3 PDB entries) 
Domain d2d5ba1: 2d5b A:349-500 [131268]
Other proteins in same PDB: d2d5ba2
automated match to d2d5ba1
complexed with zn; mutant
Details for d2d5ba1
PDB Entry: 2d5b (more details), 1.8 Å
PDB Description: crystal structure of thermus thermophilus methionyl trna synthetase y225f mutant obtained in the presence of peg6000
PDB Compounds: (A:) Methionyl-tRNA synthetaseSCOPe Domain Sequences for d2d5ba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d5ba1 a.27.1.0 (A:349-500) automated matches {Thermus thermophilus [TaxId: 274]}
laddlgnlvqrtramlfrfaegripepvageelaegtglagrlrplvrelkfhvaleeam
ayvkalnryinekkpwelfkkepeearavlyrvveglriasilltpampdkmaelrralg
lkeevrleeaerwglaeprpipeeapvlfpkk
SCOPe Domain Coordinates for d2d5ba1:
Click to download the PDB-style file with coordinates for d2d5ba1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2d5ba1:
- d2d5ba1 first appeared in SCOP 1.73
- d2d5ba1 appears in SCOPe 2.07
View in 3D
