Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.8: CoA-binding domain [51900] (6 proteins) |
Protein Hypothetical protein PH1109 [141934] (1 species) |
Species Pyrococcus horikoshii [TaxId:53953] [141935] (4 PDB entries) Uniprot O58836 1-142 |
Domain d2d59a_: 2d59 A: [131266] automated match to d1iuka_ |
PDB Entry: 2d59 (more details), 1.65 Å
SCOPe Domain Sequences for d2d59a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d59a_ c.2.1.8 (A:) Hypothetical protein PH1109 {Pyrococcus horikoshii [TaxId: 53953]} trpidgltdedireiltrykkialvgaspkperdanivmkyllehgydvypvnpkyeevl grkcypsvldipdkievvdlfvkpkltmeyveqaikkgakvvwfqyntynreaskkadea gliivanrcmmreherllgek
Timeline for d2d59a_: