![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
![]() | Protein automated matches [190123] (130 species) not a true protein |
![]() | Species Thermus thermophilus HB8 [TaxId:300852] [189850] (10 PDB entries) |
![]() | Domain d2d2fa_: 2d2f A: [203882] automated match to d1vpla_ complexed with adp, gol, mg |
PDB Entry: 2d2f (more details), 1.9 Å
SCOPe Domain Sequences for d2d2fa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d2fa_ c.37.1.0 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} sqleirdlwasidgetilkgvnlvvpkgevhalmgpngagkstlgkilagdpeytverge illdgenilelspderarkglflafqypvevpgvtianflrlalqaklgrevgvaefwtk vkkalelldwdesylsrylnegfsggekkrneilqllvleptyavldetdsgldidalkv vargvnamrgpnfgalvithyqrilnyiqpdkvhvmmdgrvvatggpelaleleakgyew lkekvk
Timeline for d2d2fa_: