Lineage for d2d1va_ (2d1v A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2308617Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) (S)
    binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family
  5. 2308708Family a.4.6.0: automated matches [191513] (1 protein)
    not a true family
  6. 2308709Protein automated matches [190858] (24 species)
    not a true protein
  7. 2308712Species Bacillus subtilis [TaxId:1423] [225130] (3 PDB entries)
  8. 2308714Domain d2d1va_: 2d1v A: [203860]
    automated match to d1gxqa_

Details for d2d1va_

PDB Entry: 2d1v (more details), 2.4 Å

PDB Description: crystal structure of dna-binding domain of bacillus subtilis yycf
PDB Compounds: (A:) Transcriptional regulatory protein yycF

SCOPe Domain Sequences for d2d1va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d1va_ a.4.6.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
ssneihigslvifpdayvvskrdetielthrefellhylakhigqvmtrehllqtvwgyd
yfgdvrtvdvtvrrlrekiednpshpnwivtrrgvgyylrnpe

SCOPe Domain Coordinates for d2d1va_:

Click to download the PDB-style file with coordinates for d2d1va_.
(The format of our PDB-style files is described here.)

Timeline for d2d1va_: