Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.114: DsrEFH-like [75168] (1 superfamily) 3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 43215 |
Superfamily c.114.1: DsrEFH-like [75169] (3 families) |
Family c.114.1.1: DsrEF-like [75170] (6 proteins) Pfam PF02635 |
Protein tRNA 2-thiouridine synthesizing protein C, TusC [142104] (1 species) formerly hypothetical protein YheM |
Species Escherichia coli [TaxId:562] [142105] (1 PDB entry) Uniprot P45531 1-119 |
Domain d2d1pb1: 2d1p B:1-119 [131137] Other proteins in same PDB: d2d1pa1, d2d1pa2, d2d1pc1, d2d1pd2, d2d1pd3, d2d1pf_, d2d1pg2, d2d1pg3, d2d1pi_ complexed with so4 |
PDB Entry: 2d1p (more details), 2.15 Å
SCOPe Domain Sequences for d2d1pb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d1pb1 c.114.1.1 (B:1-119) tRNA 2-thiouridine synthesizing protein C, TusC {Escherichia coli [TaxId: 562]} mkriafvfstaphgtaagregldallatsaltddlavffiadgvfqllpgqkpdavlard yiatfkllglydieqcwvcaaslrergldpqtpfvveatpleadalrrelanydvilrf
Timeline for d2d1pb1: