Lineage for d2d1pb1 (2d1p B:1-119)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2528392Fold c.114: DsrEFH-like [75168] (1 superfamily)
    3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 43215
  4. 2528393Superfamily c.114.1: DsrEFH-like [75169] (3 families) (S)
  5. 2528394Family c.114.1.1: DsrEF-like [75170] (6 proteins)
    Pfam PF02635
  6. 2528424Protein tRNA 2-thiouridine synthesizing protein C, TusC [142104] (1 species)
    formerly hypothetical protein YheM
  7. 2528425Species Escherichia coli [TaxId:562] [142105] (1 PDB entry)
    Uniprot P45531 1-119
  8. 2528426Domain d2d1pb1: 2d1p B:1-119 [131137]
    Other proteins in same PDB: d2d1pa1, d2d1pa2, d2d1pc1, d2d1pd2, d2d1pd3, d2d1pf_, d2d1pg2, d2d1pg3, d2d1pi_
    complexed with so4

Details for d2d1pb1

PDB Entry: 2d1p (more details), 2.15 Å

PDB Description: crystal structure of heterohexameric TusBCD proteins, which are crucial for the tRNA modification
PDB Compounds: (B:) Hypothetical UPF0116 protein yheM

SCOPe Domain Sequences for d2d1pb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d1pb1 c.114.1.1 (B:1-119) tRNA 2-thiouridine synthesizing protein C, TusC {Escherichia coli [TaxId: 562]}
mkriafvfstaphgtaagregldallatsaltddlavffiadgvfqllpgqkpdavlard
yiatfkllglydieqcwvcaaslrergldpqtpfvveatpleadalrrelanydvilrf

SCOPe Domain Coordinates for d2d1pb1:

Click to download the PDB-style file with coordinates for d2d1pb1.
(The format of our PDB-style files is described here.)

Timeline for d2d1pb1: