![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.50: TrmB-like [109680] (2 proteins) The N- and C-terminal helical extensions to the common fold form the dimer interface, distinct from other known families |
![]() | Protein Hypothetical transcriptional regulator ST1889 [140273] (1 species) |
![]() | Species Sulfolobus tokodaii [TaxId:111955] [140274] (1 PDB entry) Uniprot Q96ZE4 1-109 |
![]() | Domain d2d1ha1: 2d1h A:1-109 [131125] |
PDB Entry: 2d1h (more details), 2.05 Å
SCOPe Domain Sequences for d2d1ha1:
Sequence, based on SEQRES records: (download)
>d2d1ha1 a.4.5.50 (A:1-109) Hypothetical transcriptional regulator ST1889 {Sulfolobus tokodaii [TaxId: 111955]} mmkekleskkdeirccykitdtdvavllkmveiekpitseeladifklskttvenslkkl ielglvvrtktegkkigrpkyyysissnilekirndllncakrmelaat
>d2d1ha1 a.4.5.50 (A:1-109) Hypothetical transcriptional regulator ST1889 {Sulfolobus tokodaii [TaxId: 111955]} mmkekleskkdeirccykitdtdvavllkmveiekpitseeladifklskttvenslkkl ielglvvrtktpkyyysissnilekirndllncakrmelaat
Timeline for d2d1ha1: