Lineage for d2d0wa_ (2d0w A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304252Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2304253Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2305066Family a.3.1.0: automated matches [191374] (1 protein)
    not a true family
  6. 2305067Protein automated matches [190453] (25 species)
    not a true protein
  7. 2305116Species Hyphomicrobium denitrificans [TaxId:53399] [187593] (1 PDB entry)
  8. 2305117Domain d2d0wa_: 2d0w A: [163543]
    automated match to d2c8sa1
    complexed with hem, zn

Details for d2d0wa_

PDB Entry: 2d0w (more details), 1.98 Å

PDB Description: Crystal structure of cytochrome cL from Hyphomicrobium denitrificans
PDB Compounds: (A:) cytochrome cL

SCOPe Domain Sequences for d2d0wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d0wa_ a.3.1.0 (A:) automated matches {Hyphomicrobium denitrificans [TaxId: 53399]}
aqevfrntvtgealdvegqapkegrdtpavkqfmqtgvdpyvevagclpkgeeiylescs
gchghigegkvgpglndsywtypknttdkglfetifggangmmgphgqdleldnmlklia
wirhiqkddvadadwlsdeqkknfkpfdikaweatgkaaaekaqckis

SCOPe Domain Coordinates for d2d0wa_:

Click to download the PDB-style file with coordinates for d2d0wa_.
(The format of our PDB-style files is described here.)

Timeline for d2d0wa_: