| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) ![]() dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
| Family d.58.4.2: Lrp/AsnC-like transcriptional regulator C-terminal domain [69733] (5 proteins) octamer: tetramer of dimers automatically mapped to Pfam PF01037 |
| Protein automated matches [254502] (2 species) not a true protein |
| Species Pyrococcus horikoshii [TaxId:53953] [255099] (1 PDB entry) |
| Domain d2cyya2: 2cyy A:65-151 [131029] Other proteins in same PDB: d2cyya1 automated match to d2cyya2 complexed with ca, gln |
PDB Entry: 2cyy (more details), 1.8 Å
SCOPe Domain Sequences for d2cyya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cyya2 d.58.4.2 (A:65-151) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
ysmlafilvkvkagkysevasnlakypeivevyettgdydmvvkirtknseelnnfldli
gsipgvegthtmivlkthkettelpik
Timeline for d2cyya2: