Lineage for d2cyya2 (2cyy A:65-151)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2556580Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2556594Family d.58.4.2: Lrp/AsnC-like transcriptional regulator C-terminal domain [69733] (5 proteins)
    octamer: tetramer of dimers
    automatically mapped to Pfam PF01037
  6. 2556633Protein automated matches [254502] (2 species)
    not a true protein
  7. 2556634Species Pyrococcus horikoshii [TaxId:53953] [255099] (1 PDB entry)
  8. 2556635Domain d2cyya2: 2cyy A:65-151 [131029]
    Other proteins in same PDB: d2cyya1
    automated match to d2cyya2
    complexed with ca, gln

Details for d2cyya2

PDB Entry: 2cyy (more details), 1.8 Å

PDB Description: Crystal structure of PH1519 from Pyrococcus horikosii OT3
PDB Compounds: (A:) Putative HTH-type transcriptional regulator PH1519

SCOPe Domain Sequences for d2cyya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cyya2 d.58.4.2 (A:65-151) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
ysmlafilvkvkagkysevasnlakypeivevyettgdydmvvkirtknseelnnfldli
gsipgvegthtmivlkthkettelpik

SCOPe Domain Coordinates for d2cyya2:

Click to download the PDB-style file with coordinates for d2cyya2.
(The format of our PDB-style files is described here.)

Timeline for d2cyya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2cyya1