Class b: All beta proteins [48724] (180 folds) |
Fold b.55: PH domain-like barrel [50728] (3 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) |
Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (13 proteins) Pfam PF00640 |
Protein EPS8-like protein 1, EPS8L1 [141424] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [141425] (1 PDB entry) Uniprot Q8R5F8 31-159 |
Domain d2cy4a1: 2cy4 A:31-159 [131017] complexed with ca has additional insertions and/or extensions that are not grouped together |
PDB Entry: 2cy4 (more details), 1.94 Å
SCOPe Domain Sequences for d2cy4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cy4a1 b.55.1.2 (A:31-159) EPS8-like protein 1, EPS8L1 {Mouse (Mus musculus) [TaxId: 10090]} advsqyhvnhlvtfclgeedgvhtvedasrklavmdsqgrvwaqemllrvspsqvtlldp vskeelesypldaivrcdavmprgrsrsllllvcqeperaqpdvhffqglllgaelired iqgalqnyr
Timeline for d2cy4a1: