Lineage for d2cwka1 (2cwk A:6-158)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) 
Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins) Protein Nucleoside diphosphate kinase, NDK [54921] (23 species) 
Species Pyrococcus horikoshii [TaxId:53953] [143284] (6 PDB entries)
Uniprot O58429 3-155
Domain d2cwka1: 2cwk A:6-158 [130925]
Other proteins in same PDB: d2cwkb_
Details for d2cwka1
PDB Entry: 2cwk (more details), 1.75 Å
PDB Description: Crystal structure of nucleotide diphosphate kinase from Pyrococcus horikoshii
PDB Compounds: (A:) nucleoside-diphosphate kinaseSCOPe Domain Sequences for d2cwka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cwka1 d.58.6.1 (A:6-158) Nucleoside diphosphate kinase, NDK {Pyrococcus horikoshii [TaxId: 53953]}
etertlviikpdavvrgligeiisrfekkglkivgmkmiwidrelaekhyeehrekpffk
alidyitktpvvvmvlegryavevvrkmagatdpkdaapgtirgdfglevsdaicnviha
sdskesaereislffkpeelfeypraadwfykk
SCOPe Domain Coordinates for d2cwka1:
Click to download the PDB-style file with coordinates for d2cwka1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2cwka1:
- d2cwka1 first appeared in SCOP 1.73
- d2cwka1 appears in SCOPe 2.07
View in 3D
