SCOPe 2.04: Domain d2cvza1: 2cvz A:158-289

Lineage for d2cvza1 (2cvz A:158-289)

Root: SCOPe 2.04
Class a: All alpha proteins [46456] (285 folds)

Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

Family a.100.1.1: Hydroxyisobutyrate and 6-phosphogluconate dehydrogenase domain [48180] (3 proteins)
Hydroxyisobutyrate dehydrogenase domain is similar to one structural repeat in the 6-phosphogluconate dehydrogenase domain

Protein Hydroxyisobutyrate dehydrogenase [101357] (3 species)
forms similar dimeric and tetrameric structures to the 6-phosphogluconate dehydrogenase domain and its dimer, respectively
Species Thermus thermophilus [TaxId:274] [101358] (2 PDB entries)
structural genomics
Domain d2cvza1: 2cvz A:158-289 [130890]
Other proteins in same PDB: d2cvza2, d2cvzb2, d2cvzc2, d2cvzd2
automatically matched to d1j3va1
complexed with ndp

Details for d2cvza1

PDB Entry: 2cvz (more details), 1.8 Å

PDB Description: Structure of hydroxyisobutyrate dehydrogenase from thermus thermophilus HB8

PDB Compounds: (A:) 3-hydroxyisobutyrate dehydrogenase

SCOPe Domain Sequences for d2cvza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cvza1 a.100.1.1 (A:158-289) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]}
vgaghavkainnallavnlwaagegllalvkqgvsaekalevinassgrsnatenlipqr
vltrafpktfalgllvkdlgiamgvldgekapspllrlarevyemakrelgpdadhveal
rllerwggveir

SCOPe Domain Coordinates for d2cvza1:

Click to download the PDB-style file with coordinates for d2cvza1.
(The format of our PDB-style files is described here.)

Timeline for d2cvza1: