Lineage for d2cvda1 (2cvd A:76-199)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1735625Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1735626Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1735627Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 1736098Protein Class sigma GST [81351] (5 species)
  7. 1736111Species Human (Homo sapiens) [TaxId:9606] [89061] (7 PDB entries)
    Uniprot O60760; synonym: hematopoietic prostaglandin D synthase
  8. 1736112Domain d2cvda1: 2cvd A:76-199 [130861]
    Other proteins in same PDB: d2cvda2, d2cvdb2, d2cvdc2, d2cvdd2
    automated match to d1iyha1
    complexed with gol, gsh, hql, mg

Details for d2cvda1

PDB Entry: 2cvd (more details), 1.45 Å

PDB Description: Crystal structure analysis of human hematopoietic prostaglandin D synthase complexed with HQL-79
PDB Compounds: (A:) glutathione-requiring prostaglandin d synthase

SCOPe Domain Sequences for d2cvda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cvda1 a.45.1.1 (A:76-199) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]}
dlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnelltynaphlmqdldtyl
ggrewligmsvtwadfyweicsttllvfkpdlldnhprlvtlrkkvqaipavanwikrrp
qtkl

SCOPe Domain Coordinates for d2cvda1:

Click to download the PDB-style file with coordinates for d2cvda1.
(The format of our PDB-style files is described here.)

Timeline for d2cvda1: