Lineage for d2cv9a1 (2cv9 A:1-252)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1046630Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 1046631Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 1046864Family d.159.1.10: TTHA0625-like [143938] (1 protein)
    part of Pfam PF00149
  6. 1046865Protein Hypothetical protein TTHA0625 [143939] (1 species)
  7. 1046866Species Thermus thermophilus [TaxId:274] [143940] (2 PDB entries)
    Uniprot Q5SKL8 1-252
  8. 1046871Domain d2cv9a1: 2cv9 A:1-252 [130855]
    Other proteins in same PDB: d2cv9b_, d2cv9c_, d2cv9d_

Details for d2cv9a1

PDB Entry: 2cv9 (more details), 2.5 Å

PDB Description: Crystal structure of a hypothetical protein from Thermus thermophilus HB8
PDB Compounds: (A:) hypothetical protein TTHA0625

SCOPe Domain Sequences for d2cv9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cv9a1 d.159.1.10 (A:1-252) Hypothetical protein TTHA0625 {Thermus thermophilus [TaxId: 274]}
mrvlfigdvmaepglravglhlpdirdrydlviangenaargkgldrrsyrllreagvdl
vslgnhawdhkevyallesepvvrplnyppgtpgkgfwrlevggesllfvqvmgrifmdp
lddpfraldrlleeekadyvlvevhaeatsekmalahyldgrasavlgththvptldatr
lpkgtlyqtdvgmtgtyhsiiggevetflarfltgrpqpfraaqgkarfhatelvfeggr
pvaispyvweep

SCOPe Domain Coordinates for d2cv9a1:

Click to download the PDB-style file with coordinates for d2cv9a1.
(The format of our PDB-style files is described here.)

Timeline for d2cv9a1: