Lineage for d2cunb_ (2cun B:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.86: Phosphoglycerate kinase [53747] (1 superfamily)
    consists of two non-similar domains, 3 layers (a/b/a) each
    Domain 1 has parallel beta-sheet of 6 strands, order 342156
    Domain 2 has parallel beta-sheet of 6 strands, order 321456
  4. Superfamily c.86.1: Phosphoglycerate kinase [53748] (2 families) (S)
  5. Family c.86.1.0: automated matches [191414] (1 protein)
    not a true family
  6. Protein automated matches [190573] (6 species)
    not a true protein
  7. Species Pyrococcus horikoshii OT3 [TaxId:70601] [187569] (1 PDB entry)
  8. Domain d2cunb_: 2cun B: [163472]
    automated match to d1vpea_
    complexed with 3pg, cl, gol, mpd

Details for d2cunb_

PDB Entry: 2cun (more details), 2.1 Å

PDB Description: Crystal structure of Phosphoglycerate Kinase from Pyrococcus horikoshii OT3
PDB Compounds: (B:) phosphoglycerate kinase

SCOPe Domain Sequences for d2cunb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cunb_ c.86.1.0 (B:) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]}
mfrledfnfhnktvflrvdlnspmkdgkiisdarfkavlptiryliesgakvvigthqgk
pysedyttteeharvlselldqhveyiedifgryarekikelksgevailenlrfsaeev
knkpieecektflvkklskvidyvvndafatahrsqpslvgfarikpmimgflmekeiea
lmrayyskdspkiyvlggakvedslkvvenvlrreradlvltgglvanvftlakgfdlgr
knvefmkkkglldyvkhaeeildefypyirtpvdfavdykgerveidllsenrgllhqyq
imdigkrtaekyreilmkariivangpmgvfereefaigtvevfkaiadspafsvlgggh
siasiqkygitgithistgggamlsffageelpvlralqisyekf

SCOPe Domain Coordinates for d2cunb_ are not available.

Timeline for d2cunb_:

Domains from other chains:
(mouse over for more information)
d2cuna_