Lineage for d2cufa1 (2cuf A:8-89)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2691779Family a.4.1.1: Homeodomain [46690] (41 proteins)
    Pfam PF00046
  6. 2691856Protein Homeobox-containing protein 1, HMBOX1 (Flj21616) [140159] (1 species)
  7. 2691857Species Human (Homo sapiens) [TaxId:9606] [140160] (1 PDB entry)
    Uniprot Q6NT76 268-350
  8. 2691858Domain d2cufa1: 2cuf A:8-89 [130809]
    Other proteins in same PDB: d2cufa2, d2cufa3

Details for d2cufa1

PDB Entry: 2cuf (more details)

PDB Description: solution structure of the homeobox domain of the human hypothetical protein flj21616
PDB Compounds: (A:) FLJ21616 protein

SCOPe Domain Sequences for d2cufa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]}
rgsrftwrkeclavmesyfnenqypdeakreeianacnaviqkpgkklsdlervtslkvy
nwfanrrkeikrraniaailes

SCOPe Domain Coordinates for d2cufa1:

Click to download the PDB-style file with coordinates for d2cufa1.
(The format of our PDB-style files is described here.)

Timeline for d2cufa1: