Lineage for d2ct5a1 (2ct5 A:8-67)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 892092Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
    simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC
  4. 892093Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (7 families) (S)
  5. 892356Family g.37.1.6: BED zinc finger [144157] (1 protein)
    Pfam PF02892; contains extra N-terminal and C-terminal helices bundled together with the core helix
  6. 892357Protein Zinc finger BED domain-containing protein 1 [144158] (1 species)
    dREF homolog
  7. 892358Species Human (Homo sapiens) [TaxId:9606] [144159] (1 PDB entry)
    Uniprot O96006 23-82
  8. 892359Domain d2ct5a1: 2ct5 A:8-67 [130790]
    complexed with zn

Details for d2ct5a1

PDB Entry: 2ct5 (more details)

PDB Description: solution structure of the zinc finger bed domain of the zinc finger bed domain containing protein 1
PDB Compounds: (A:) Zinc finger BED domain containing protein 1

SCOP Domain Sequences for d2ct5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ct5a1 g.37.1.6 (A:8-67) Zinc finger BED domain-containing protein 1 {Human (Homo sapiens) [TaxId: 9606]}
skvwkyfgfdtnaegcilqwkkiycricmaqiaysgntsnlsyhleknhpeefcefvksn

SCOP Domain Coordinates for d2ct5a1:

Click to download the PDB-style file with coordinates for d2ct5a1.
(The format of our PDB-style files is described here.)

Timeline for d2ct5a1: