Lineage for d2cs5a1 (2cs5 A:8-113)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2056344Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2056345Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2056346Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 2056632Protein Tyrosine-protein phosphatase non-receptor type 4, PTPN4 [141286] (1 species)
  7. 2056633Species Human (Homo sapiens) [TaxId:9606] [141287] (3 PDB entries)
    Uniprot P29074 507-612
  8. 2056640Domain d2cs5a1: 2cs5 A:8-113 [130747]
    Other proteins in same PDB: d2cs5a2, d2cs5a3

Details for d2cs5a1

PDB Entry: 2cs5 (more details)

PDB Description: solution structure of pdz domain of protein tyrosine phosphatase, non- receptor type 4
PDB Compounds: (A:) Tyrosine-protein phosphatase, non-receptor type 4

SCOPe Domain Sequences for d2cs5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]}
nggiphdnlvlirmkpdengrfgfnvkggydqkmpvivsrvapgtpadlcvprlnegdqv
vlingrdiaehthdqvvlfikascerhsgelmllvrpnavydvvee

SCOPe Domain Coordinates for d2cs5a1:

Click to download the PDB-style file with coordinates for d2cs5a1.
(The format of our PDB-style files is described here.)

Timeline for d2cs5a1: