Lineage for d2cria1 (2cri A:8-141)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.11: PapD-like [49354] (3 families) (S)
    contains PP switch between strands D and C'
  5. Family b.1.11.0: automated matches [227286] (1 protein)
    not a true family
  6. Protein automated matches [227104] (3 species)
    not a true protein
  7. Species Mouse (Mus musculus) [TaxId:10090] [255092] (1 PDB entry)
  8. Domain d2cria1: 2cri A:8-141 [241475]
    Other proteins in same PDB: d2cria2, d2cria3
    automated match to d1wica_

Details for d2cria1

PDB Entry: 2cri (more details)

PDB Description: Solution structure of the MSP domain of mouse VAMP-associated proteinA
PDB Compounds: (A:) Vesicle-associated membrane protein-associated protein A

SCOPe Domain Sequences for d2cria1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cria1 b.1.11.0 (A:8-141) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
makheqilvldppsdlkfkgpftdvvttnlklqnpsdrkvcfkvkttaprrycvrpnsgi
idpgsivtvsvmlqpfdydpnekskhkfmvqtifappnisdmeavwkeakpdelmdsklr
cvfempnendklnd

SCOPe Domain Coordinates for d2cria1 are not available.

Timeline for d2cria1:

Domains from same chain:
(mouse over for more information)
d2cria2, d2cria3