Lineage for d2crba1 (2crb A:8-90)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 763928Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 764239Superfamily a.7.16: MIT domain-like [140361] (1 family) (S)
  5. 764240Family a.7.16.1: MIT domain [140362] (1 protein)
    this is a repeat family; one repeat unit is 2crb A:8-90 found in domain
  6. 764241Protein Nuclear receptor binding factor 2, NRBF2, N-terminal domain [140363] (1 species)
  7. 764242Species Mouse (Mus musculus) [TaxId:10090] [140364] (1 PDB entry)
    Uniprot Q8VCQ3 4-86
  8. 764243Domain d2crba1: 2crb A:8-90 [130737]
    mutant

Details for d2crba1

PDB Entry: 2crb (more details)

PDB Description: solution structure of mit domain from mouse nrbf-2
PDB Compounds: (A:) nuclear receptor binding factor 2

SCOP Domain Sequences for d2crba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2crba1 a.7.16.1 (A:8-90) Nuclear receptor binding factor 2, NRBF2, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
megplnlahqqsrradrllaagkyeeaischrkattylseamklteseqahlslelqrds
hmkqllliqerwkrakreerlka

SCOP Domain Coordinates for d2crba1:

Click to download the PDB-style file with coordinates for d2crba1.
(The format of our PDB-style files is described here.)

Timeline for d2crba1: